PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01190g04010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 326aa    MW: 36211.7 Da    PI: 7.8241
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01190g04010.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.73.8e-19244277134
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                               Cs+C++ kTp+WR gp g+ktLCnaCG++y++ +
  Niben101Scf01190g04010.1 244 CSHCQVQKTPQWRAGPLGPKTLCNACGVRYKSGR 277
                               *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169928.0E-785322IPR016679Transcription factor, GATA, plant
SuperFamilySSF577168.08E-15237300No hitNo description
SMARTSM004011.4E-15238292IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.281238274IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.1E-14241275IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.15E-13243292No hitNo description
PfamPF003206.7E-17244277IPR000679Zinc finger, GATA-type
PROSITE patternPS003440244269IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MELIEARALK SSFLSDMATK TSQQVFLDDI WCVTGINNVP SDDFSVDDLL NFSDKDFKDG  60
QSLQELHEDD EKDSFSGSSQ HRNYQVSNFS CMDSFSGELP VPVDELENLE WLSQFVDDST  120
SEFSLLCPAG SFKDKTGFFH VSRSEPVTRP VVQKMRVPCF PLPVVQKPRT KRSRPAGRKW  180
SFSSPTVSAD SCSPTSSSYG SSPFPSVLFT NPVRDSDLFC SVGKPPLKKP KRISSAETGS  240
GRRCSHCQVQ KTPQWRAGPL GPKTLCNACG VRYKSGRLFP EYRPACSPSF SQEVHSNSHR  300
KVLEMRRKKE SGEVVDSGLA SMISTC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802570.10.0PREDICTED: GATA transcription factor 5-like
TrEMBLQ76DY00.0Q76DY0_TOBAC; AG-motif binding protein-4
STRINGSolyc01g110310.2.11e-168(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11542481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-62GATA transcription factor 5